PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008240449.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 384aa    MW: 42968.5 Da    PI: 8.4222
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008240449.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.21.8e-5491371128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+ +yL+kkv++++l++ ++i+evdiyk++Pw+Lp+k++ +ekewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++++
  XP_008240449.1   9 LPPGFRFHPTDEELILHYLTKKVASTPLPV-SIIAEVDIYKFDPWELPAKAAFGEKEWYFFSPRDRKYPNGARPNRAAASGYWKATGTDKTIVAS 102
                     79****************************.89***************988899****************************************9 PP

             NAM  96 ..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       ++++vg+kk Lvfykgr pkg kt+W+mheyrl
  XP_008240449.1 103 lgGRQNVGVKKALVFYKGRPPKGIKTNWIMHEYRL 137
                     988999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-655171IPR003441NAC domain
PROSITE profilePS5100562.5559171IPR003441NAC domain
PfamPF023651.5E-2710137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 384 aa     Download sequence    Send to blast
MMKNPESSLP PGFRFHPTDE ELILHYLTKK VASTPLPVSI IAEVDIYKFD PWELPAKAAF  60
GEKEWYFFSP RDRKYPNGAR PNRAAASGYW KATGTDKTIV ASLGGRQNVG VKKALVFYKG  120
RPPKGIKTNW IMHEYRLPEN PNNYTTTSKT MKLKDLSMRL DDWVLCRIYK KSNVSSSAAV  180
PPIDHEEEVE EEEDFLHDVL LPSLKSPLPG LGHNMSTNNT DLMPQKSSSF SNLLDAMDYS  240
LLTSFLADGQ YSNPTGTGLQ STPNRFPCSG TTGLDQKPLF INDYSNISSS SSSSKSHLLQ  300
KLPQFNGLNL PAIPSTESRL KRHDHPIADD HGLLYPSKKY VNSNCSFNHA TIQSDNISQG  360
HLLNHSLLNH QQLVLSSPQF QFQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-72817319170NAC domain-containing protein 19
3swm_B1e-72817319170NAC domain-containing protein 19
3swm_C1e-72817319170NAC domain-containing protein 19
3swm_D1e-72817319170NAC domain-containing protein 19
3swp_A1e-72817319170NAC domain-containing protein 19
3swp_B1e-72817319170NAC domain-containing protein 19
3swp_C1e-72817319170NAC domain-containing protein 19
3swp_D1e-72817319170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00333DAPTransfer from AT3G04070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8227100.0KR822710.1 Prunus persica NAC transcription factor NAC3 (NAC3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008240449.10.0PREDICTED: NAC transcription factor 25
SwissprotA0SPJ93e-91NAM2_HORVD; NAC transcription factor NAM-2
TrEMBLA0A0P0KKI10.0A0A0P0KKI1_PRUPE; NAC transcription factor NAC3
STRINGPOPTR_0019s04690.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66212750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.13e-94NAC domain containing protein 47